Protein coding transcript 78738

• Transcript: Ll_transcript_342562
• CDS coordinates: 125-955 (+)
• Peptide sequence: MALIPSSYSLVSSLNLLFLLSLQCKVASSAIILSLRHHHNQVNHKRPMIHANQSNCEVFMGTWVRDGTYPLYQSSNCPIIDPQFNCQMYGRPDSDYLKYRWRPLNCDLPRFNGVEFLLGMRGKTVMFVGDSLGRNQWQSLICMISTSVPQTQTQLVRGEPLSTFRFLDYGVTISFYKAPYLVEIDVVQGKKILSLEKLDGNGDAWRSADVLSFNTGHWWSHQGSLQGWDYMELGGKYYQDMDRLAALEKGLKTWANWVDTNIDKSRTKVFFLGISPS
• ORF Type: 3prime_partial

Annotations of Ll_transcript_342562

• Blastp: Protein PMR5 from Arabidopsis with 58.93% of identity
• Blastx: Protein PMR5 from Arabidopsis with 60.15% of identity
• Eggnog: Pfam:DUF231(ENOG410YF78)
• Kegg: Link to kegg annotations (AT5G58600)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447004.1)
• Pfam: PMR5 N terminal Domain (PF14416.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;