Protein coding transcript 788

• Transcript: Ll_transcript_468641
• CDS coordinates: 322-684 (+)
• Peptide sequence: MEPGHNYFERGNLDIFSGRGACLDGPVCAVNVTSDGSGAHHGWYVNYVEVTSTGVHKTCAQKQFTLEQWVGTDVSPYQLWAQRDYCGNQTGLGLARSKTTVVDDVGSGSGYSILDLGVRV*
• ORF Type: complete

Annotations of Ll_transcript_468641

• Blastp: PLAT domain-containing protein 1 from Arabidopsis with 65.12% of identity
• Blastx: PLAT domain-containing protein 2 from Arabidopsis with 63.5% of identity
• Eggnog: wound stress protein(ENOG410ZKR3)
• Kegg: Link to kegg annotations (AT4G39730)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019415958.1)
• Pfam: PLAT/LH2 domain (PF01477.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;