Transcript | Ll_transcript_343757 |
---|---|
CDS coordinates | 256-1398 (+) |
Peptide sequence | MEKGVRERIKTTRQVIGEAKESFDNQIKIQKLKDTIFAVNEQLTKAKKQGAFSSLIAAKSIPKSLHCVSMRLMEERIAHPEKYSDEGKPIPPEVEDPKLYHYAIFSDNVVAASVVVNSATKNAKEPWKHVFHVVTDKMNLGAMQVMFKLKNYNGAHVEVKAVEDYKFLNSSYVPVLRQLESANLQRFYFENKLENATKDTTNMKFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQKDLTGLWKIDMDGKVNGAVETCFGSFHRYAQYMNFSHPLIKAKFNPKACAWAYGMNFFDLDAWRREKCTEEYHYWQNLNENRTLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISMDEIRNAAVVHFNGNMKPWL |
ORF Type | 3prime_partial |
Blastp | Galacturonosyltransferase 8 from Arabidopsis with 92.89% of identity |
---|---|
Blastx | Galacturonosyltransferase 8 from Arabidopsis with 87.98% of identity |
Eggnog | Galacturonosyltransferase(ENOG410YC9Z) |
Kegg | Link to kegg annotations (AT3G25140) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019461511.1) |
Pfam | Glycosyl transferase family 8 (PF01501.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer