Transcript | Ll_transcript_343118 |
---|---|
CDS coordinates | 152-475 (+) |
Peptide sequence | MGEKDPVAPGATRGETPRLKVIDQKLRQQRVFQQMTMMETHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDIDKHILARQTGLSRSQVSNWFINARVRLCKPMVEEM |
ORF Type | 3prime_partial |
Blastp | Homeobox protein BEL1 homolog from Arabidopsis with 80.61% of identity |
---|---|
Blastx | Homeobox protein BEL1 homolog from Arabidopsis with 69.77% of identity |
Eggnog | homeobox(ENOG410XPMQ) |
Kegg | Link to kegg annotations (AT5G41410) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019444657.1) |
Pfam | Homeobox KN domain (PF05920.10) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer