| Transcript | Ll_transcript_343120 |
|---|---|
| CDS coordinates | 766-1119 (+) |
| Peptide sequence | MKSVVSSFEAVAGNGAATVYSALALKAMSRHFRCLKDGILGQIEATRKSMGEKDPIAPGTTRGETPRLKVIDQALRQQRAFQQMTMMETHPWRPQRGLPERSVSVLRAWLFEHFLHP* |
| ORF Type | complete |
| Blastp | Homeobox protein BEL1 homolog from Arabidopsis with 32.47% of identity |
|---|---|
| Blastx | BEL1-like homeodomain protein 2 from Arabidopsis with 60.63% of identity |
| Eggnog | homeobox(ENOG410XPMQ) |
| Kegg | Link to kegg annotations (AT5G41410) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019421229.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer