Protein coding transcript 78867

• Transcript: Ll_transcript_343776
• CDS coordinates: 3-320 (+)
• Peptide sequence: LKELIKYKGYQVPPAELEALLLTHPAISDAAVIPYPDSEAGQVPMGYIVRKTGSSLSEKEVMDFVAKQVAPYKRIRRVTFISSVPKNASGKILRKDLIKLATSKL*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_343776

• Blastp: 4-coumarate--CoA ligase-like 5 from Arabidopsis with 81.73% of identity
• Blastx: 4-coumarate--CoA ligase-like 5 from Arabidopsis with 81.73% of identity
• Eggnog: Amp-dependent synthetase and ligase(COG0318)
• Kegg: Link to kegg annotations (AT1G20510)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449501.1)
• Pfam: AMP-binding enzyme C-terminal domain (PF13193.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;