| Transcript | Ll_transcript_343778 |
|---|---|
| CDS coordinates | 3-491 (+) |
| Peptide sequence | CLFISIKTVFYSFYFYFVSSSPPIPTRRHFTFPQLWLAVDSVPSALSSLGIRKGDVVLLLSPNSIYFPVMSLGAIVTTTNPLNTANEIAKQINDSKPVIAFTTSQLITKIIASSPKLPIILIEENEELQHSGVIDNHHSDFPSSLNVGDNHSYVLCEFFKDAQ |
| ORF Type | internal |
| Blastp | - |
|---|---|
| Blastx | 4-coumarate--CoA ligase-like 5 from Arabidopsis with 67.71% of identity |
| Eggnog | Amp-dependent synthetase and ligase(COG0318) |
| Kegg | Link to kegg annotations (AT1G20510) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019414061.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer