Transcript | Ll_transcript_343172 |
---|---|
CDS coordinates | 88-588 (+) |
Peptide sequence | MEKIEHTTVTTNGIKMHVASIGSGPVILFLHGFPELWYSWRHQLLSLSALGYRAIAPDLRGYGDTDAPPSASSYSAVHIVGDIVGLLDALGIDQVLLVGHDWGASMAWYFSLLRPDRVKALVNLSVTFRPRNPRRKPVESLRALMGDDYYMCRFQVSENYSVKCHFD |
ORF Type | 3prime_partial |
Blastp | Bifunctional epoxide hydrolase 2 from Homo with 42.03% of identity |
---|---|
Blastx | Bifunctional epoxide hydrolase 2 from Homo with 42.03% of identity |
Eggnog | Hydrolase(COG1011) |
Kegg | Link to kegg annotations (2053) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019418845.1) |
Pfam | alpha/beta hydrolase fold (PF00561.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer