Transcript | Ll_transcript_343176 |
---|---|
CDS coordinates | 88-798 (+) |
Peptide sequence | MEKIEHTTVTTNGIKMHVASIGSGPVILFLHGFPELWYSWRHQLLSLSALGYRAIAPDLRGYGDTDAPPSASSYSAVHIVGDIVGLLDALGIDQVLLVGHDWGASMAWYFSLLRPDRVKALVNLSVTFRPRNPRRKPVESLRALMGDDYYMCRFQKPGEAEEEFARVGTARILKTFLTLRDPRPLCVPKEIGFEGLANISNTLPSWLSEEDINYYASKFDQKGFTGGLNYYRALDL* |
ORF Type | complete |
Blastp | Bifunctional epoxide hydrolase 2 from Homo with 38.14% of identity |
---|---|
Blastx | Bifunctional epoxide hydrolase 2 from Homo with 38.14% of identity |
Eggnog | Hydrolase(COG1011) |
Kegg | Link to kegg annotations (2053) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019418845.1) |
Pfam | alpha/beta hydrolase fold (PF00561.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer