Transcript | Ll_transcript_343443 |
---|---|
CDS coordinates | 933-1442 (+) |
Peptide sequence | MDITEALDGKNDADDSETSFAVGKSPENLKVASEKIYGAHGLGEGTPKSERSDDKFCDDIFGETPTGVRKSGKGDGLLIEKVGLHDNWDDAEGYYSYRFGEILDGRYEVTAAHGMGVFSTVVRAKNLKDSNGEPEEVAIKIIRSNDTMYKAGMDESIILKKLVGADPDDK |
ORF Type | 3prime_partial |
Blastp | Serine/threonine-protein kinase PRP4 homolog from Mus with 49.12% of identity |
---|---|
Blastx | Serine/threonine-protein kinase PRP4 homolog from Bos with 49.12% of identity |
Eggnog | PRP4 pre-mRNA processing factor 4 homolog B (yeast)(ENOG410XPAX) |
Kegg | Link to kegg annotations (19134) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019427638.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer