| Transcript | Ll_transcript_341246 |
|---|---|
| CDS coordinates | 1-330 (+) |
| Peptide sequence | ICGFSCLFWFLFLLINVYFKLSQDWLVYQLRNIWQMLVINQYCWRQEMFLVERLLHGKTKMETGMRQAYTYSVSLLIVRLKFLLYICFLNCLRKVLHFPIPLVNIFLFL* |
| ORF Type | 5prime_partial |
| Blastp | - |
|---|---|
| Blastx | Phytoene dehydrogenase, chloroplastic/chromoplastic from Zea with 97.96% of identity |
| Eggnog | Desaturase(COG3349) |
| Kegg | Link to kegg annotations (542329) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019438286.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer