Protein coding transcript 78983

• Transcript: Ll_transcript_341244
• CDS coordinates: 259-837 (+)
• Peptide sequence: MAFLDGNPPERLCMPIVDHIQSLGGEVHLNSRIQKIELNDDGTVKSFLLNNGKVIEGDTYVFATPVDILKLLLPDSWKEIPYFQRLEKLVGVPVINVHIWFDRKLKNTYDHLLFSRSSSHFETHMIRNAVHFMSHSFVIHKLILCLIFVLHKVHIFLLCSPLVAKLGTYNIEWNNSLPPSPPWVKNINDNRM*
• ORF Type: complete

Annotations of Ll_transcript_341244

• Blastp: Phytoene dehydrogenase, chloroplastic/chromoplastic from Soja with 94.87% of identity
• Blastx: Phytoene dehydrogenase, chloroplastic/chromoplastic from Soja with 95.12% of identity
• Eggnog: Desaturase(COG3349)
• Kegg: Link to kegg annotations (547970)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019415584.1)
• Pfam: Flavin containing amine oxidoreductase (PF01593.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;