Transcript | Ll_transcript_342491 |
---|---|
CDS coordinates | 156-545 (+) |
Peptide sequence | MHVHTLYMLTHMFVTSIQIGPFHGSHGCKTKAKVQVQLNLHGIVCIESATLIEDCVDASVTTDDRHSNFEAMDTELNSKTVVNDTEDTVNKRCGSPCASAVSTLILPPIPMKDLRCPRFIVKHPPGMKD* |
ORF Type | complete |
Blastp | Heat shock 70 kDa protein 16 from Arabidopsis with 38.71% of identity |
---|---|
Blastx | Heat shock 70 kDa protein 15 from Arabidopsis with 37.36% of identity |
Eggnog | Heat shock protein(COG0443) |
Kegg | Link to kegg annotations (AT1G11660) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019459857.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer