Protein coding transcript 79044

• Transcript: Ll_transcript_341300
• CDS coordinates: 109-420 (+)
• Peptide sequence: MLQFMVCCFKLCFLYSLYCMPSSLAASCSSMQCKKSNLIIGNVTVQQTGGGCNVTSCYYDGIANGTIITTLSPSLQPRCPGQSAAAAYIFRFQMHCRTALFAF*
• ORF Type: complete

Annotations of Ll_transcript_341300

• Blastp: LysM domain-containing GPI-anchored protein 1 from Arabidopsis with 58.62% of identity
• Blastx: LysM domain-containing GPI-anchored protein 1 from Arabidopsis with 46.77% of identity
• Eggnog: lysM domain-containing GPI-anchored protein(ENOG410YAMN)
• Kegg: Link to kegg annotations (AT1G21880)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019438572.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;