Transcript | Ll_transcript_342431 |
---|---|
CDS coordinates | 2-316 (+) |
Peptide sequence | TNLSNLNHPITSKLVASTFRHRVTQSTHLSPFSTAAEVAAESQYYEDSVGITTKGVKIFGRPLYLDVQATSPVNLRVFDTMFPFNISRYRNPITPLSTHTIKVS* |
ORF Type | 5prime_partial |
Blastp | Cysteine desulfurase, mitochondrial from Arabidopsis with 44.83% of identity |
---|---|
Blastx | Cysteine desulfurase, mitochondrial from Arabidopsis with 44.83% of identity |
Eggnog | cysteine desulfurase(COG1104) |
Kegg | Link to kegg annotations (AT5G65720) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019423755.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer