Protein coding transcript 79083

• Transcript: Ll_transcript_342432
• CDS coordinates: 2-316 (+)
• Peptide sequence: TNLSNLNHPITSKLVASTFRHRVTQSTHLSPFSTAAEVAAESQYYEDSVGITTKGVKIFGRPLYLDVQATSPVNLRVFDTMFPFNISRYRNPITPLSTHTIKVS*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_342432

• Blastp: Cysteine desulfurase, mitochondrial from Arabidopsis with 44.83% of identity
• Blastx: Cysteine desulfurase, mitochondrial from Arabidopsis with 44.83% of identity
• Eggnog: cysteine desulfurase(COG1104)
• Kegg: Link to kegg annotations (AT5G65720)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019423755.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;