Protein coding transcript 79096

• Transcript: Ll_transcript_342904
• CDS coordinates: 127-969 (+)
• Peptide sequence: MQEMRGIFLRKLKLNPTISNFKQGLVLQLNPQDVFFNSIYDDHKGINNLAELEDVVDDDIDKLFEEEEMDFEVKISNKDKATQTLGSKETKHAEEKLLPLAPNNLFKPNMDLNIVPSIADFEELCPPGGNNLVILYTTSLRGIRKTFQDCNTIHFLLRSFKILYQERDVSLHLEYREELWKILGGKVIPPKLFVKGRYIGGADEVVGLHEMGWLGKLFEGVATDNSDFTCIGCSNIRFVICSNCCGSCKVFTSNRDTSDEGFIKCSECNENGLVKCPICS*
• ORF Type: complete

Annotations of Ll_transcript_342904

• Blastp: Uncharacterized protein At5g39865 from Arabidopsis with 40.96% of identity
• Blastx: Uncharacterized protein At5g39865 from Arabidopsis with 40.96% of identity
• Eggnog: Glutaredoxin(ENOG4111HAI)
• Kegg: Link to kegg annotations (AT5G39865)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019455002.1)
• Pfam: Glutaredoxin (PF00462.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;