Transcript | Ll_transcript_342597 |
---|---|
CDS coordinates | 531-1106 (+) |
Peptide sequence | MDWNLKSPSLDLTEVDQASTFPNMETMDEGSSRFGVYSTKGEFSVDLKLGQVGNFGTESMLSKPKGAASDAGLSKMASTLASGSSKRARAFNNGNHTVTCLVDGCNSDLSNCRDYHRRHKVCELHSKTPQVTIGGQKQRFCQQCSRFHSLEEFDEGKRSCRKRLDGHNRRRRKPQPEPLTRSSNFLSNYQG* |
ORF Type | complete |
Blastp | Squamosa promoter-binding-like protein 13B from Arabidopsis with 55.33% of identity |
---|---|
Blastx | Squamosa promoter-binding-like protein 13B from Arabidopsis with 55.33% of identity |
Eggnog | Squamosa promoter-binding-like protein(ENOG410YD0Z) |
Kegg | Link to kegg annotations (AT5G50570) |
CantataDB | - |
Mirbase | bdi-MIR156j (MI0029151) |
Ncbi protein | Link to NCBI protein (XP_019464709.1) |
Pfam | SBP domain (PF03110.13) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer