Transcript | Ll_transcript_342606 |
---|---|
CDS coordinates | 1093-1557 (+) |
Peptide sequence | MDWNLKSPSLDLTEVDQGTTFPNMETVDEGSSRFGVYRTKSDFSVDLKLGQVGNFGIESVMAKPKDTYAAAGVSKMLSSPSGSSKRARAFNNGNHIVTCLVDECKSDLSNCRDYHRRHKVCELHSKSPQVTISGQKQRFCQQCSRFVYIEFFSF* |
ORF Type | complete |
Blastp | Squamosa promoter-binding-like protein 13B from Arabidopsis with 46.91% of identity |
---|---|
Blastx | Squamosa promoter-binding-like protein 13B from Arabidopsis with 48.08% of identity |
Eggnog | Squamosa promoter-binding-like protein(ENOG410YD0Z) |
Kegg | Link to kegg annotations (AT5G50570) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019457623.1) |
Pfam | SBP domain (PF03110.13) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer