Protein coding transcript 79213

• Transcript: Ll_transcript_342780
• CDS coordinates: 320-967 (+)
• Peptide sequence: MSDHLVLYVDRLVRPIPVEPMSQDPVQPSPEPSVLVDAAAVAGPSDSSLMESDGEGEGEDEEERLLQMAECRICQEEDSVSNLESPCTCRGSLKYAHRKCVQHWCNEKGDITCEICHKPYQPGYTAPPPCPRPEETTIDIVGGWTISGTPLDLHDPRLLAIAEAERQFLEAEYDGYASSNASGAAFCRSAALILMALLLLRHALSVTDADAEDDPS
• ORF Type: 3prime_partial

Annotations of Ll_transcript_342780

• Blastp: ERAD-associated E3 ubiquitin-protein ligase DOA10 from Saccharomyces with 43.55% of identity
• Blastx: ERAD-associated E3 ubiquitin-protein ligase DOA10 from Saccharomyces with 43.55% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (YIL030C)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445941.1)
• Pfam: RING-variant domain (PF12906.6)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;