Transcript | Ll_transcript_341157 |
---|---|
CDS coordinates | 778-1413 (+) |
Peptide sequence | MGRKGNWFLSVKKALSPEPKERKDQKSSKSKKKWFGKQKLQTSEAYSETDNAPSLPAPEEIILTYVENENSNDHVVEVATVLEAEEPVLAVQTTADKVQITAVDQFTGKPNDEVAAMRIQTAFRGYMARRALRALRGLDRLKSLMEGKVVKRQTINTLRSMQTFAHLQSQIHSRRLRMLEETQAMQKLLLQKHAKELEIVRVSGFQCPDLF* |
ORF Type | complete |
Blastp | Protein IQ-DOMAIN 1 from Arabidopsis with 39.09% of identity |
---|---|
Blastx | Protein IQ-DOMAIN 1 from Arabidopsis with 44.74% of identity |
Eggnog | NA(ENOG411040N) |
Kegg | Link to kegg annotations (AT3G09710) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019428081.1) |
Pfam | IQ calmodulin-binding motif (PF00612.26) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer