Protein coding transcript 79466

• Transcript: Ll_transcript_342752
• CDS coordinates: 699-1181 (+)
• Peptide sequence: MTKYNKSGIAGSSEPQYEQSEMDSSSSSSSEDEEEEIEKELADVTFEELQKARSNGAHAFSKKPREDQKLKRANKNRPMEASSKKPVPAFREVVQAPKKVVRDPRFESLCGTLDTDGFRKRYNFLFESDLPAEKETLKKELRRYKDPERVHEIEERLSWID
• ORF Type: 3prime_partial

Annotations of Ll_transcript_342752

• Blastp: rRNA biogenesis protein rrp36 from Schizosaccharomyces with 31.49% of identity
• Blastx: Ribosomal RNA processing protein 36 homolog from Mus with 37.98% of identity
• Eggnog: Component of the 90S pre-ribosome involved in the maturation of rRNAs. Required for early cleavages of the pre-RNAs in the 40S ribosomal subunit maturation pathway (By similarity)(ENOG4111T3E)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019431463.1)
• Pfam: rRNA biogenesis protein RRP36 (PF06102.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;