Protein coding transcript 79493

• Transcript: Ll_transcript_343329
• CDS coordinates: 1090-1449 (+)
• Peptide sequence: MDGNMSNEIELLVVSSQKGQALMFPKGGWELDETIEEAACRESLEEAGVTGIIEQSELGQWSFISKRHGTYYEGHMLPLFVNEQLDMWPEKDLRRRVWVCLRPTLIIHVFYFTFRKDYV*
• ORF Type: complete

Annotations of Ll_transcript_343329

• Blastp: Nudix hydrolase 18, mitochondrial from Arabidopsis with 64.29% of identity
• Blastx: Nudix hydrolase 17, mitochondrial from Arabidopsis with 62.96% of identity
• Eggnog: Nudix hydrolase(COG0494)
• Kegg: Link to kegg annotations (AT1G14860)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462060.1)
• Pfam: NUDIX domain (PF00293.27)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;