Transcript | Ll_transcript_341556 |
---|---|
CDS coordinates | 164-880 (+) |
Peptide sequence | MSNHHRSSSASSKNGLPPQELLDDLCSRFVLNVPKEDLQSFERILFLVENAHWFYEDNSVENNPSLKSLSLKEFTSLLFNTCEVLKPYVAHIDDIFKDFTSYKVRVPVTGAIILDETYERCILVKGWKGSSWSFPRGKKSKDEEDHACAIREVMEETGFDVSKLLHKDEYLEIIFGQQRVRLYIVAGVKDDTVFAPLTKKEISEIAWHRLDELQPASDDVISRGITGLKLYMVSPFLA* |
ORF Type | complete |
Blastp | mRNA-decapping enzyme subunit 2 from Arabidopsis with 81.67% of identity |
---|---|
Blastx | mRNA-decapping enzyme subunit 2 from Arabidopsis with 59.31% of identity |
Eggnog | Nudix hydrolase(COG0494) |
Kegg | Link to kegg annotations (AT5G13570) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019413476.1) |
Pfam | Dcp2, box A domain (PF05026.12) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer