Transcript | Ll_transcript_343972 |
---|---|
CDS coordinates | 443-880 (+) |
Peptide sequence | MVSGSKAEHYKRNAEHLLAVFENRLKDMAMAVPLMCCAADMLRVPSRKQVVVVGERTSEEFESMLAAAHSLYDPNRTVIHIDPNNEEEVKFWEVNNSNIALMAKNNYKDNKVVALVCQNFTCSPPVTDHSSLEALISQKSPSYST* |
ORF Type | complete |
Blastp | Spermatogenesis-associated protein 20 from Homo with 25.83% of identity |
---|---|
Blastx | Spermatogenesis-associated protein 20 from Homo with 34.98% of identity |
Eggnog | mannose-6-phosphate isomerase activity(COG1331) |
Kegg | Link to kegg annotations (64847) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019419203.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer