| Transcript | Ll_transcript_343974 |
|---|---|
| CDS coordinates | 101-466 (+) |
| Peptide sequence | MLQRLRFVHSSSLLHHHHHHLLHQPTKSKSHFYNYQYYPFSIPPLKVFSMATSSSSSHSHNYTNRLVSEQSPYLLQHAHNPVEWYPWGEEAFSIARKRDVPIFLSSTSSYTIFFNSLLLSL* |
| ORF Type | complete |
| Blastp | Uncharacterized protein YyaO from Bacillus with 59.18% of identity |
|---|---|
| Blastx | Uncharacterized protein YyaO from Bacillus with 60.42% of identity |
| Eggnog | mannose-6-phosphate isomerase activity(COG1331) |
| Kegg | Link to kegg annotations (BSU40790) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019419202.1) |
| Pfam | Protein of unknown function, DUF255 (PF03190.14) |
| Rfam | - |
| GO | - |
Grab and slide to change sequence position
Alignmet by MSA Viewer