Protein coding transcript 79646

• Transcript: Ll_transcript_343978
• CDS coordinates: 443-880 (+)
• Peptide sequence: MVSGSKAEHYKRNAEHLLAVFENRLKDMAMAVPLMCCAADMLRVPSRKQVVVVGERTSEEFESMLAAAHSLYDPNRTVIHIDPNNEEEVKFWEVNNSNIALMAKNNYKDNKVVALVCQNFTCSPPVTDHSSLEALISQKSPSYST*
• ORF Type: complete

Annotations of Ll_transcript_343978

• Blastp: Spermatogenesis-associated protein 20 from Homo with 25.83% of identity
• Blastx: Spermatogenesis-associated protein 20 from Homo with 34.98% of identity
• Eggnog: mannose-6-phosphate isomerase activity(COG1331)
• Kegg: Link to kegg annotations (64847)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419203.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;