Protein coding transcript 79703

• Transcript: Ll_transcript_343605
• CDS coordinates: 630-1457 (+)
• Peptide sequence: MLYARQEKECVGVYLFDFTWNRMDHHGNGQNPNMGVPYGSNPYQQNQMIGAPGSVVTSAGNMQSSGQPTGAQLGQHQLAYQHIHQQQQQQLQQQLQQFWVNQYQEIEKVTDFKNHSLPLARIKKIMKADEDVRMISAEAPVIFARACEMFILELTLRSWNHTEENKRRTLQKNDIAAAITRTDIFDFLVDIVPREDLKDEVLASIPRGAMPVAGPADALPYMYMQPQHAPQVGAPGFIMGKPVMDPNMYAQQPHPYMAPHMWPQPQDQQPSSPDY*
• ORF Type: complete

Annotations of Ll_transcript_343605

• Blastp: Nuclear transcription factor Y subunit C-9 from Arabidopsis with 63.9% of identity
• Blastx: Nuclear transcription factor Y subunit C-9 from Arabidopsis with 64.17% of identity
• Eggnog: Nuclear transcription factor Y(COG5208)
• Kegg: Link to kegg annotations (AT1G08970)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440551.1)
• Pfam: Core histone H2A/H2B/H3/H4 (PF00125.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;