Transcript | Ll_transcript_343594 |
---|---|
CDS coordinates | 622-1419 (+) |
Peptide sequence | MLLCFMHAKKRRMDHHGNGQNPNMGVPYGSNPYQQNQMIGAPGSVVTSAGNMQSSGQPTGAQLGQHQLAYQHIHQQQQQQLQQQLQQFWVNQYQEIEKVTDFKNHSLPLARIKKIMKADEDVRMISAEAPVIFARACEMFILELTLRSWNHTEENKRRTLQKNDIAAAITRTDIFDFLVDIVPREDLKDEVLASIPRGAMPVAGPADALPYMYMQPQHAPQVGAPGFIMGKPVMDPNMYAQQPHPYMAPHMWPQPQDQQPSSPDY* |
ORF Type | complete |
Blastp | Nuclear transcription factor Y subunit C-9 from Arabidopsis with 63.9% of identity |
---|---|
Blastx | Nuclear transcription factor Y subunit C-9 from Arabidopsis with 64.17% of identity |
Eggnog | Nuclear transcription factor Y(COG5208) |
Kegg | Link to kegg annotations (AT1G08970) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019440551.1) |
Pfam | Core histone H2A/H2B/H3/H4 (PF00125.23) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer