Protein coding transcript 79716

• Transcript: Ll_transcript_343597
• CDS coordinates: 142-888 (+)
• Peptide sequence: MDHQGHGQNPNMGVVGSGTQLPYGSNPYQQSQMTGAPGPVVTSSGNMQSALAYQHIHQQQQQQLQQQLQQFWANQYQEIEKVTDFKNHSLPLARIKKIMKADEDVRMISAEAPVIFARACEMFILELTLRSWNHTEENKRRTLQKNDIAAAITRTDIFDFLVDIVPREDLKDEVLASIPRGTMQVAGPADTIPYMYMPPQHAPQAGAPGVIMGKPVMDPNMYAQQPHPYMAPQMWPQPQDQRPSSPDH*
• ORF Type: complete

Annotations of Ll_transcript_343597

• Blastp: Nuclear transcription factor Y subunit C-9 from Arabidopsis with 64.41% of identity
• Blastx: Nuclear transcription factor Y subunit C-9 from Arabidopsis with 63.56% of identity
• Eggnog: Nuclear transcription factor Y(COG5208)
• Kegg: Link to kegg annotations (AT1G08970)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419871.1)
• Pfam: Core histone H2A/H2B/H3/H4 (PF00125.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;