Protein coding transcript 79718

• Transcript: Ll_transcript_343600
• CDS coordinates: 265-867 (+)
• Peptide sequence: MMSASKFIKCVTVGDGAVGKTCMLICYTSNKFPTDYIPTVFDNFSANVAVDGSIVNLGLWDTAGQEDYSRLRPLSYRGADIFVLAFSLISRASYENVLKKWMPELRRFAPNVPVVLVGTKLDLREDHRYFADHMGSNVITSAEGEELRKQIGAAAYIECSSKTQQNVKAVFDTAIKVVLQPPRRKEMARKKRRGSGCSLV*
• ORF Type: complete

Annotations of Ll_transcript_343600

• Blastp: Rac-like GTP-binding protein ARAC7 from Arabidopsis with 89.5% of identity
• Blastx: Rac-like GTP-binding protein ARAC7 from Arabidopsis with 89.5% of identity
• Eggnog: GTP-binding Protein(COG1100)
• Kegg: Link to kegg annotations (AT4G28950)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458061.1)
• Pfam: Ras family (PF00071.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;