Transcript | Ll_transcript_341989 |
---|---|
CDS coordinates | 490-1512 (+) |
Peptide sequence | MNRGVLQSSPVQQMMAGNPNWWNINTMRPPNVPQTPPFFSNTTPSNFLNPYPQNSSFPFTSLHDNQELPESWSHLLMDGLVGEEDKGGMDQFQTKRLENCWEDQMLSQAQNASFVDVKQERSVNSYVYGHGNEHELQTPKTTTWSPNSCVTSFSTNMLDFSNNKNDARHPLPDPSSECNSSGGGGGVLKKARVQPSTTQSTMKVRKEKLGDRVTALHQLVSPFGKTDTASVLLEAIGYIRFLQSQIEALTLPYLNSGSGNPRQHHSVQGEKNCIFPEDPGQLVNENCLKRKAPMEQDSQEEPNKDLKSRGLCLVPVSCTQQVGSESGADYWAPTLGGGFQ* |
ORF Type | complete |
Blastp | Transcription factor bHLH68 from Arabidopsis with 48.08% of identity |
---|---|
Blastx | Transcription factor bHLH68 from Arabidopsis with 48.08% of identity |
Eggnog | Transcription factor(ENOG410YDA0) |
Kegg | Link to kegg annotations (AT4G29100) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019436625.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer