Protein coding transcript 79757

• Transcript: Ll_transcript_341999
• CDS coordinates: 490-1308 (+)
• Peptide sequence: MNRGVLQSSPVQQMMAGNPNWWNINTMRPPNVPQTPPFFSNTTPSNFLNPYPQNSSFPFTSLHDNQELPESWSHLLMDGLVGEEDKGGMDQFQTKRLENCWEDQMLSQAQNASFVDVKQERSVNSYVYGHGNEHELQTPKTTTWSPNSCVTSFSTNMLDFSNNKNDARHPLPDPSSECNSSGGGGGVLKKARVQPSTTQSTMKVRKEKLGDRVTALHQLVSPFGKVSLRIQIKNRVNIHFSFYAFQLYQVSQKLIKQKDSTTNLNIGQINPY*
• ORF Type: complete

Annotations of Ll_transcript_341999

• Blastp: Transcription factor bHLH68 from Arabidopsis with 41.02% of identity
• Blastx: Transcription factor bHLH68 from Arabidopsis with 41.02% of identity
• Eggnog: Transcription factor(ENOG410YDA0)
• Kegg: Link to kegg annotations (AT4G29100)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019436625.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;