Protein coding transcript 79811

• Transcript: Ll_transcript_342100
• CDS coordinates: 119-457 (+)
• Peptide sequence: MHIKSKGGASELSARSVIPRKWALLLCIGSFYAEMFFTNRMWSMPECKEISRTSSEVEKIKLNPEGCNLNLVVKTNTNYGRMDVSNSQNDIKKASKTTFTSELNLKFALVCC*
• ORF Type: complete

Annotations of Ll_transcript_342100

• Blastp: Probable beta-1,3-galactosyltransferase 2 from Arabidopsis with 41.59% of identity
• Blastx: Probable beta-1,3-galactosyltransferase 2 from Arabidopsis with 42.51% of identity
• Eggnog: Beta-1,3-galactosyltransferase(ENOG410XV5H)
• Kegg: Link to kegg annotations (AT1G05170)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462490.1)
• Pfam: Domain of unknown function (DUF4094) (PF13334.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;