| Transcript | Ll_transcript_341714 |
|---|---|
| CDS coordinates | 263-634 (+) |
| Peptide sequence | MKVTTTTNINYCYNLLMEDQQSSSSSKPKTADLDAPLHSIGFEIEELSPQKVSGHLLVTQKCCQVKPTSIFFLVIITISLCFLNVSKKFPFFFFAKNKVLINIPRLKLYKFCWAVLVLGCSMT* |
| ORF Type | complete |
| Blastp | 1,4-dihydroxy-2-naphthoyl-CoA thioesterase 1 from Arabidopsis with 47.5% of identity |
|---|---|
| Blastx | - |
| Eggnog | thioesterase Superfamily protein(COG2050) |
| Kegg | Link to kegg annotations (AT1G48320) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019415889.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer