Protein coding transcript 79864

• Transcript: Ll_transcript_341719
• CDS coordinates: 263-634 (+)
• Peptide sequence: MKVTTTTNINYCYNLLMEDQQSSSSSKPKTADLDAPLHSIGFEIEELSPQKVSGHLLVTQKCCQVKPTSIFFLVIITISLCFLNVSKKFPFFFFAKNKVLINIPRLKLYKFCWAVLVLGCSMT*
• ORF Type: complete

Annotations of Ll_transcript_341719

• Blastp: 1,4-dihydroxy-2-naphthoyl-CoA thioesterase 1 from Arabidopsis with 47.5% of identity
• Blastx: 1,4-dihydroxy-2-naphthoyl-CoA thioesterase 1 from Arabidopsis with 83.33% of identity
• Eggnog: thioesterase Superfamily protein(COG2050)
• Kegg: Link to kegg annotations (AT1G48320)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019415889.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;