Transcript | Ll_transcript_341723 |
---|---|
CDS coordinates | 263-703 (+) |
Peptide sequence | MKVTTTTNINYCYNLLMEDQQSSSSSKPKTADLDAPLHSIGFEIEELSPQKVSGHLLVTQKCCQPFKVLHGGVSAMIAEALASMGAHMASGYKRVAGIQLNINHLKRADMGDLVQAEATPLSVGRTIQVLFLISSFLFFGWESYHQ* |
ORF Type | complete |
Blastp | 1,4-dihydroxy-2-naphthoyl-CoA thioesterase 1 from Arabidopsis with 70.48% of identity |
---|---|
Blastx | 1,4-dihydroxy-2-naphthoyl-CoA thioesterase 1 from Arabidopsis with 69.81% of identity |
Eggnog | thioesterase Superfamily protein(COG2050) |
Kegg | Link to kegg annotations (AT1G48320) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019415889.1) |
Pfam | Thioesterase superfamily (PF03061.21) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer