Transcript | Ll_transcript_343279 |
---|---|
CDS coordinates | 1550-1864 (+) |
Peptide sequence | MLPAIFKSCSDMISKWEEMLSSDGSCELDVWPFLQSLASEVISRTAFGDNHEEGRRIFELQKEQAELMMKVVLHVNIPGWRYDYYVHVNYVTNKEGSNLLRINH* |
ORF Type | complete |
Blastp | Cytochrome P450 CYP72A219 from Panax with 56.1% of identity |
---|---|
Blastx | Cytochrome P450 CYP72A219 from Panax with 55.13% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019453527.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer