Protein coding transcript 79892

• Transcript: Ll_transcript_343273
• CDS coordinates: 1-633 (+)
• Peptide sequence: SAYKIDEYKPMTLSHDIVPRVLPFVHQSVNKHGKNSFIWFGPIPRLTITDPQLIKDVLNNIHSFPKVSTNPLIRLLVTGLITHGGDKWSKHRRIINPAFNIEKLKIMLPAIFKSCSDMISKWEEMLSSDGSCELDVWPFLQSLASEVISRTAFGDNHEEGRRIFELQKEQAELMMKVVLHVNIPGWRYDYYVHVNYVTNKEGSNLLRINH*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_343273

• Blastp: Cytochrome P450 72A13 from Arabidopsis with 50.28% of identity
• Blastx: Cytochrome P450 72A13 from Arabidopsis with 50.28% of identity
• Eggnog: Cytochrome p450(COG2124)
• Kegg: Link to kegg annotations (AT3G14660)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453527.1)
• Pfam: Cytochrome P450 (PF00067.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;