Protein coding transcript 799

• Transcript: Ll_transcript_468617
• CDS coordinates: 72-593 (+)
• Peptide sequence: MAFSISASSTLVSLNYQRSTLFAPTSSSSTKLSSFSSLQFPVHTQLLHISSSSSLRPRILPLVVEAKKQSFSTFDELLDNADKPVLVDFYATWCGPCQFMVPILNEVSTRLNDKIQVVKIDTEKYPSIATKYDIQALPTFIIFKDGEPYDRFEGAMTADQLIERIETTLKVKQ*
• ORF Type: complete

Annotations of Ll_transcript_468617

• Blastp: Thioredoxin Y1, chloroplastic from Arabidopsis with 63.91% of identity
• Blastx: Thioredoxin Y1, chloroplastic from Arabidopsis with 79.82% of identity
• Eggnog: Thioredoxin(COG0526)
• Kegg: Link to kegg annotations (AT1G76760)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427791.1)
• Pfam: Thioredoxin (PF00085.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;