Protein coding transcript 79967

• Transcript: Ll_transcript_341640
• CDS coordinates: 185-559 (+)
• Peptide sequence: MNNLDNDDFIKQMLSSSLDQTSILPFPSSYHQHPSNKPLMLNQHFLMSSHFGSSQNDVVHSSSFNSPIHGASNHDTQHFQQSHGGSNQMQAPTGATLAQPKQRVRARRGQATDPHSIAERARFS*
• ORF Type: complete

Annotations of Ll_transcript_341640

• Blastp: Transcription factor bHLH69 from Arabidopsis with 58.49% of identity
• Blastx: Transcription factor bHLH69 from Arabidopsis with 58.49% of identity
• Eggnog: Helix-loop-helix DNA-binding domain(ENOG4111CIP)
• Kegg: Link to kegg annotations (AT4G30980)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019463399.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;