| Transcript | Ll_transcript_456708 |
|---|---|
| CDS coordinates | 102-425 (+) |
| Peptide sequence | MFVFVQVRREKISERMKYLQDLVPGCNKITGKAGMLDEIINYVQSLQRQVEVSFESLQSLPFTLIYRKLSYCYFHCRLYTIDHFITNGSLYFLHIPMNTSLKSPATQ* |
| ORF Type | complete |
| Blastp | Transcription factor bHLH63 from Arabidopsis with 33.83% of identity |
|---|---|
| Blastx | Transcription factor bHLH63 from Arabidopsis with 91.3% of identity |
| Eggnog | Transcription factor(ENOG410YGAM) |
| Kegg | Link to kegg annotations (AT4G34530) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019414084.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer