Transcript | Ll_transcript_456714 |
---|---|
CDS coordinates | 265-1218 (+) |
Peptide sequence | MLHCLNTSGNVGGTCSDMKVFEIQRARKKQQHHEDQQQQQQQHPQGLMMMMMMGCGDSVLGDVVAQSMKSDPGLENGLPEFGMFDMSMGFESSLLPHASGFDVNSSVSRTCSRDMALPTQKKETFKKRKAEKIRNSKVVAESDNKEKKIKVSGDEEESNNKNTKAKANTNKNNKEACGESSKENSKESEVQNPKPDYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNKITGKAGMLDEIINYVQSLQRQVEVSFESLQSLPFTLIYRKLSYCYFHCRLYTIDHFITNGSLYFLHIPMNTSLKSPATQ* |
ORF Type | complete |
Blastp | Transcription factor HBI1 from Arabidopsis with 49.27% of identity |
---|---|
Blastx | Transcription factor bHLH63 from Arabidopsis with 92.65% of identity |
Eggnog | basic helix-loop-helix (bHLH) family protein(ENOG411190E) |
Kegg | Link to kegg annotations (AT2G18300) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019414084.1) |
Pfam | Helix-loop-helix DNA-binding domain (PF00010.25) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer