Protein coding transcript 80018

• Transcript: Ll_transcript_456723
• CDS coordinates: 653-1111 (+)
• Peptide sequence: MKYLQDLVPGCNKITGKAGMLDEIINYVQSLQRQVEFLSMKLAAVNPRLDFNIDDLFAKEVFPACSSSFPNIGVQSDITTTNPAYLHFNPAQLVSCCNGLMNNMGINPSDLGLRRTTSAPVSLPETFIDSSSCFTQILPSSSWEGHFQNLYNN
• ORF Type: 3prime_partial

Annotations of Ll_transcript_456723

• Blastp: Transcription factor bHLH63 from Arabidopsis with 46.71% of identity
• Blastx: Transcription factor bHLH63 from Arabidopsis with 54.27% of identity
• Eggnog: Transcription factor(ENOG410YGAM)
• Kegg: Link to kegg annotations (AT4G34530)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019414084.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;