Transcript | Ll_transcript_457027 |
---|---|
CDS coordinates | 357-893 (+) |
Peptide sequence | MRKMMADKALVRRLSACETMGSATTICSDKTGTLTMNQMTVVEAYAGGKKIDPPHNKSELSPMLHSLLIEGVAQNTNGSVYVPEVGNDVEVSGSPTEKAILHWALKLGMNFTEARSQSSIVHVFPFNSEKKRGGVAIQTANSEVHIHWKGAAEIVLACCTSYIDANEQLVEMDEEKMTF |
ORF Type | 3prime_partial |
Blastp | Calcium-transporting ATPase 8, plasma membrane-type from Arabidopsis with 70.39% of identity |
---|---|
Blastx | Calcium-transporting ATPase 8, plasma membrane-type from Arabidopsis with 71% of identity |
Eggnog | ATPase, Ca transporting, plasma membrane(ENOG410XNNC) |
Kegg | Link to kegg annotations (AT5G57110) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019431135.1) |
Pfam | Cation transport ATPase (P-type) (PF13246.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer