Protein coding transcript 80111

• Transcript: Ll_transcript_458616
• CDS coordinates: 183-566 (+)
• Peptide sequence: MAGRLTNAASRILGGNGVVSRSVASSLRFRSGMGLPVGKHIVPDKPLPANDELVWDNGTPFPEPCIDRIADTVGKYEALAWLCGGLSFFASLGLLAVWNDKASKIPFAPKVYPYDNLRVELGGEPDV*
• ORF Type: complete

Annotations of Ll_transcript_458616

• Blastp: NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial from Arabidopsis with 84% of identity
• Blastx: NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial from Arabidopsis with 84% of identity
• Eggnog: NADH dehydrogenase ubiquinone 1 beta subcomplex subunit 8(ENOG410YKP2)
• Kegg: Link to kegg annotations (AT5G47570)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446709.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;