Transcript | Ll_transcript_277929 |
---|---|
CDS coordinates | 504-1124 (+) |
Peptide sequence | MEQTLWGHLPLLLRASTKESIEYILETLWRTRKTGLDSSHRRVIQDTLQLQNHSDLDPVGVSSSGPTFFIPKLLLCLRMLMRRCVYENTSKDDIPKLFPNEVLPELQKLLTLLLQKFQQEWQEELLKDQNIVPRLKAMTWNMGNQDKESSDPVAVINMKLQGDAQLHSREQDVKFQLATDTLDTVLKAMHCIRDQFSTTDETPNGH* |
ORF Type | complete |
Blastp | COMM domain-containing protein 9 from Bos with 32.37% of identity |
---|---|
Blastx | Protein FAR1-RELATED SEQUENCE 3 from Arabidopsis with 40.3% of identity |
Eggnog | HCaRG protein(ENOG4111H94) |
Kegg | Link to kegg annotations (510280) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019429261.1) |
Pfam | COMM domain (PF07258.13) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer