Protein coding transcript 80159

• Transcript: Ll_transcript_458005
• CDS coordinates: 161-1174 (+)
• Peptide sequence: MSDLETLIKKTVVPTTDLSGITKGKVHRFSNPTTRSPSSDTTTHSDSVVFFDNTSSSQSESTTPPPPTTTTTINIENVAGVSSAESPVAVSDEAVVVAAEKESETRSSVETVNVNGNEGGKSDDVVPAPAHIPELRKRRPRERKVPSTPFSRALGFAGLGAGLAWGTLQESTKRLVYGTPSQGNQPVFSPFLSEQNAERLALALCRMRGAALKIGQMLSIQDESLVPAPILAALEIVRQGADVMPKSQLNQVLNAELGPDWSSKLISFDYEPLAAASIGQVHRAVIKDGMHVAMKIQYPGVADSIESDIENVKLLLNYTNLIPEGLYLDRAIKVHIC*
• ORF Type: complete

Annotations of Ll_transcript_458005

• Blastp: Protein ABC transporter 1, mitochondrial from Arabidopsis with 57.18% of identity
• Blastx: Protein ABC transporter 1, mitochondrial from Arabidopsis with 77.49% of identity
• Eggnog: Required, probably indirectly, for the hydroxylation of 2-octaprenylphenol to 2-octaprenyl-6-hydroxy-phenol, the fourth step in ubiquinone biosynthesis (By similarity)(COG0661)
• Kegg: Link to kegg annotations (AT4G01660)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441253.1)
• Pfam: ABC1 family (PF03109.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;