Protein coding transcript 80171

• Transcript: Ll_transcript_457041
• CDS coordinates: 544-1191 (+)
• Peptide sequence: MKRLMRYSLGSVALGSLTVSFVESIRFLLESIRRKLKVSTHVPDSWIGKAAYQSSHCFQRCIEWIIKSVNRNAYIMIAITGKSFFRASAIATELIMNNILRIGRVNVIGDVILFLGKLCVSLSSAVIAFLMLDSHKYKSAHNKISSPLLPVMICWTLGYIVATLFFGVVEMSIDTIILSFCQDSEEHGTAQYAPPLLIETLSDNNDMQRLTQGPQ*
• ORF Type: complete

Annotations of Ll_transcript_457041

• Blastp: Choline transporter protein 1 from Arabidopsis with 72.56% of identity
• Blastx: Choline transporter protein 1 from Arabidopsis with 72.12% of identity
• Eggnog: Solute carrier family 44 member(ENOG410XS0P)
• Kegg: Link to kegg annotations (AT3G15380)
• CantataDB: Link to cantataDB annotations (CNT0002034)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019443957.1)
• Pfam: Plasma-membrane choline transporter (PF04515.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;