Protein coding transcript 802

• Transcript: Ll_transcript_468636
• CDS coordinates: 3-626 (+)
• Peptide sequence: GLQENGQGGSSEMKTPRGILNYSLNGRNASAISWKLTGNLGGEDYQDRTRGPLNEGGLYAERQGYHLPGAPTSSWSNSTHGPMIGITAPGVAFYSTTFDLDMPAGYDIPIAISFSNATSSTNGSASVAYRSQIYVNGYQFGKYVSNIGPQDVFPVPQGIFDYNGPNYLAVSLWALDEGGAKISNLSLVAGPVIQSGYGPVELSPLTGW
• ORF Type: internal

Annotations of Ll_transcript_468636

• Blastp: Probable beta-galactosidase A from Penicillium with 57.71% of identity
• Blastx: Probable beta-galactosidase A from Penicillium with 56.22% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437520.1)
• Pfam: Beta-galactosidase jelly roll domain (PF13364.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;